DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and LOC108352809

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_038948801.1 Gene:LOC108352809 / 108352809 RGDID:11400929 Length:132 Species:Rattus norvegicus


Alignment Length:120 Identity:70/120 - (58%)
Similarity:89/120 - (74%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQI 81
            |.||||||||.:||.:||.|.|...|.:|.||.|||||.:.:||...|||...|||.|||.||||
  Rat    10 GVMDINTALQGMLKTALIHDSLARDIREAAKAFDKRQAHVYVLASDCDEPMCVKLVYALCAEHQI 74

  Fly    82 PLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLR 136
            .||:.|.:||||||.||||||:||||:||..||.||::|:|:|:.|.|::|::.:
  Rat    75 NLIKADDNKKLGEWGGLCKIDREGKPQKVVVCSCVVVQDYGKESQAKDIIKEYFK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 58/94 (62%)
LOC108352809XP_038948801.1 Ribosomal_L7Ae 16..94 CDD:396000 46/77 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4755
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4062
OMA 1 1.010 - - QHG54130
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001708
OrthoInspector 1 1.000 - - otm45902
orthoMCL 1 0.900 - - OOG6_101261
Panther 1 1.100 - - O PTHR11843
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1102
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.