DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment RpS12 and nodal

DIOPT Version :9

Sequence 1:	NP_729866.1	Gene:	RpS12 / 39480	FlyBaseID:	FBgn0286213	Length:	139	Species:	Drosophila melanogaster
Sequence 2:	XP_002936396.2	Gene:	nodal / 100497218	XenbaseID:	XB-GENE-483209	Length:	398	Species:	Xenopus tropicalis

Alignment Length:	60	Identity:	15/60 - (25%)
Similarity:	24/60 - (40%)	Gaps:	12/60 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    38 LVHGIHQACKALDKRQA--VLCILAESFDEPNYKKLVTALCN--------EHQIPLIRVD 87
            |.||:..|.......::  :..:.|:|||...  .|.|.:.:        |||...:|.|
Frog    68 LSHGMEAAPSPPSNHRSDIIRSLAAKSFDHGG--SLWTLVFDFSSLSQDEEHQFAEVRFD 125

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
RpS12	NP_729866.1	Ribosomal_L7Ae	23..118	CDD:396000	15/60 (25%)
nodal	XP_002936396.2	TGFb_propeptide	51..196	CDD:413528	15/60 (25%)
nodal	XP_002936396.2	TGF_beta_NODAL	296..398	CDD:381637
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165176931
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930