DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS12 and Rps12l3

DIOPT Version :9

Sequence 1:NP_729866.1 Gene:RpS12 / 39480 FlyBaseID:FBgn0286213 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_038962493.1 Gene:Rps12l3 / 100360642 RGDID:2321715 Length:132 Species:Rattus norvegicus


Alignment Length:120 Identity:82/120 - (68%)
Similarity:99/120 - (82%) Gaps:0/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQI 81
            |.||:|||||||||.:||.||||.||.:|.||||||||.||:||.:.|||.|.|||.|||.||||
  Rat    10 GVMDVNTALQEVLKTALIHDGLVRGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQI 74

  Fly    82 PLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETPALDVVKDHLR 136
            .||:||.:||||||.||||||:|||||||.|||.||:||:|:|:.|.||::::.:
  Rat    75 NLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKDYGKESQAKDVIEEYFK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS12NP_729866.1 Ribosomal_L7Ae 23..118 CDD:396000 70/94 (74%)
Rps12l3XP_038962493.1 Ribosomal_L7Ae 16..111 CDD:396000 70/94 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H138366
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.