DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdenoK and RBK1

DIOPT Version :9

Sequence 1:NP_001287054.1 Gene:AdenoK / 39479 FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_009965.2 Gene:RBK1 / 850402 SGDID:S000000632 Length:333 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:91/347 - (26%)
Similarity:143/347 - (41%) Gaps:51/347 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQP- 81
            :.|:.:..||:         |.....|| :|..||.......|..|||...|. ..|...|:.| 
Yeast     1 MGITVIGSLNY---------DLDTFTDR-LPNAGETFRANHFETHAGGKGLNQ-AAAIGKLKNPS 54

  Fly    82 -RVAV-FFGCVGEDRYANILKEKAQAAGLDV-HYQVKKDVPTGTCAVLIT----GTHRSLCANLA 139
             |.:| ..|.||.|.:...||:.....|:|: |....:.:.|||..:||.    |.:|.|.  :.
Yeast    55 SRYSVRMIGNVGNDTFGKQLKDTLSDCGVDITHVGTYEGINTGTATILIEEKAGGQNRILI--VE 117

  Fly   140 AANNFTIDHLEE-----PSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPF-LMNLSA 198
            .||:.||...::     |..|   :..:|.....     ..|..:.:....||.:..| ::...:
Yeast   118 GANSKTIYDPKQLCEIFPEGK---EEEEYVVFQH-----EIPDPLSIIKWIHANRPNFQIVYNPS 174

  Fly   199 PFIS----QFYMAPLLA-----ALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEK-K 253
            ||.:    .:.:..||.     .|..|:.:|.||...:...:.:....|:.|:|.:.|  .|| .
Yeast   175 PFKAMPKKDWELVDLLVVNEIEGLQIVESVFDNELVEEIREKIKDDFLGEYRKICELL--YEKLM 237

  Fly   254 NPTRPRIAILTQGCDPVLLIQQDS--VQEFPVTKLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLD 316
            |..:..|.::|.|...||....:|  ||..|..:..  .:|||.||||.|:||.::|..||::|.
Yeast   238 NRKKRGIVVMTLGSRGVLFCSHESPEVQFLPAIQNV--SVVDTTGAGDTFLGGLVTQLYQGETLS 300

  Fly   317 VCIRCGNYAAGHIIKNPGCTYS 338
            ..|:....|:...|:..|...|
Yeast   301 TAIKFSTLASSLTIQRKGAAES 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 91/347 (26%)
ribokinase_pfkB_like 14..343 CDD:294126 91/347 (26%)
RBK1NP_009965.2 ribokinase 2..324 CDD:238579 91/346 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.