DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdenoK and adk

DIOPT Version :9

Sequence 1:NP_001287054.1 Gene:AdenoK / 39479 FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001016698.1 Gene:adk / 549452 XenbaseID:XB-GENE-997225 Length:361 Species:Xenopus tropicalis


Alignment Length:341 Identity:175/341 - (51%)
Similarity:241/341 - (70%) Gaps:2/341 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQEGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQN 69
            |:|.:|.|.|||||||.|||..:||.||.:..:|.|||||:|..::.|||:.::.|:.||||.||
 Frog    20 LRENLLFGMGNPLLDICAVVDKDFLDKYGLKANDQILAEDKHKELFEELVKKFKVEYHAGGSTQN 84

  Fly    70 SLRIAQWILRQP-RVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPTGTCAVLITGTHRS 133
            |:::|||::::| :||.||||:|.|::..|||:||:.|.:|.||..:.:.||||||..|||.:||
 Frog    85 SVKVAQWMIQKPYKVATFFGCIGTDKFGEILKKKAEEAHVDAHYYEQSEQPTGTCAACITGENRS 149

  Fly   134 LCANLAAANNF-TIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAKQRPFLMNLS 197
            |.|:|||||.: ...||:...|..||..|:.|||:||||||:|.||::||..:..:.:.|.||||
 Frog   150 LVAHLAAANCYDKTKHLDLKENWELVQKAKVYYIAGFFLTVSPESILKVATQSSEQNKVFCMNLS 214

  Fly   198 APFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAI 262
            ||||||||..||:..:|||||:||||.||..||..|.:.:.|::||.|:..|::|.|..||||.|
 Frog   215 APFISQFYKDPLMKVMPYVDILFGNETEAATFAREQGFETEDIKEIAKKAQALQKVNSKRPRIVI 279

  Fly   263 LTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVGGFLSQFVQGKSLDVCIRCGNYAAG 327
            .|||.|..::...:.|..|||.::...:||||||||||||||||||.|..:.|:.|:|.|:|:|.
 Frog   280 FTQGQDDTIVATDNDVVAFPVIEIDQSKIVDTNGAGDAFVGGFLSQLVSDQPLEECVRAGHYSAN 344

  Fly   328 HIIKNPGCTYSGEPEF 343
            .:|:..|||:..:|:|
 Frog   345 VVIRRAGCTFPEKPDF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 172/334 (51%)
ribokinase_pfkB_like 14..343 CDD:294126 170/330 (52%)
adkNP_001016698.1 ribokinase_pfkB_like 28..361 CDD:381848 171/333 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4891
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45769
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.