DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AdenoK and CG4686

DIOPT Version :9

Sequence 1:	NP_001287054.1	Gene:	AdenoK / 39479	FlyBaseID:	FBgn0036337	Length:	345	Species:	Drosophila melanogaster
Sequence 2:	NP_001262744.1	Gene:	CG4686 / 42361	FlyBaseID:	FBgn0038739	Length:	181	Species:	Drosophila melanogaster

Alignment Length:	46	Identity:	13/46 - (28%)
Similarity:	21/46 - (45%)	Gaps:	0/46 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   170 FLTVNPPSIMQVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPY 215
            ::|:..|....||::|.|..|...:......:.:..||.|.||..|
  Fly     9 YVTLGNPVSKMVASSASALLRTLGLRPKKVPVQETSMAVLPAAHSY 54

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AdenoK	NP_001287054.1	PTZ00247	10..343	CDD:240328	13/46 (28%)
AdenoK	NP_001287054.1	ribokinase_pfkB_like	14..343	CDD:294126	13/46 (28%)
CG4686	NP_001262744.1	ribokinase_pfkB_like	<24..114	CDD:294126	9/31 (29%)
CG4686	NP_001262744.1	DUF423	85..170	CDD:282144
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45456427
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930