DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdenoK and rbks

DIOPT Version :9

Sequence 1:NP_001287054.1 Gene:AdenoK / 39479 FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001002117.1 Gene:rbks / 415207 ZFINID:ZDB-GENE-040625-112 Length:311 Species:Danio rerio


Alignment Length:304 Identity:65/304 - (21%)
Similarity:117/304 - (38%) Gaps:34/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAVFFGC-VGEDRYANILKEKA 103
            ::::....|..||.:.|::  |..|...:.:.:..|......:.|:.  | ||.|.:.|...:..
Zfish    17 LVSQAPRFPKAGETIHGHR--FFIGFGGKGANQCVQAARMGAKTAMV--CKVGRDVFGNDYIQNF 77

  Fly   104 QAAGLDVHY--QVKKDVPTGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYI 166
            :..|:...|  |.:| ..||..::::..|..:....:|.| |..:...|....::.:.||:....
Zfish    78 KNNGISTAYVEQTEK-AATGAASIIVNDTGENAIVIVAGA-NLLLGQEELQRAQSAIINAKVLVC 140

  Fly   167 SGFFLTVNPPSIMQVAATAHAKQRPFLMNLSAPFI----SQFYMAPLLAALPYVDIIFGNEAEAQ 227
            .   |.::|.:.:|....|.......:.| .||.|    |.||.|.        |:...||:||:
Zfish   141 Q---LEISPDASLQALKMARENHVKTIFN-PAPAIAYLDSDFYKAS--------DVFCCNESEAE 193

  Fly   228 AFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIV 292
            ...........|..::|..|:   .|......:.:.:||| .|......:.:..|..::..   .
Zfish   194 MLTGLSVTSVEDACQVGLELL---NKGCASVIVTLGSQGC-VVCQSTNKTPKHIPTIEVTA---A 251

  Fly   293 DTNGAGDAFVG--GFLSQFVQGKSLDVCIRCGNYAAGHIIKNPG 334
            ||.||||:|:|  .|.........::...|..|..|...::..|
Zfish   252 DTTGAGDSFIGALAFYMAHYPAMPMEEMARRANLVAAVSVQTVG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 65/304 (21%)
ribokinase_pfkB_like 14..343 CDD:294126 65/304 (21%)
rbksNP_001002117.1 D_ribokin_bact 11..307 CDD:274000 65/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.