DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdenoK and CG7328

DIOPT Version :9

Sequence 1:NP_001287054.1 Gene:AdenoK / 39479 FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_649181.1 Gene:CG7328 / 40204 FlyBaseID:FBgn0036942 Length:306 Species:Drosophila melanogaster


Alignment Length:354 Identity:69/354 - (19%)
Similarity:127/354 - (35%) Gaps:94/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLAGGSVQNSLRI 73
            :.|||  .::|.   |.:|  ..|.|.:.|.            ..::|:   :..||:..|    
  Fly     8 LCVGC--TVIDF---VTIN--GSYPMEDTDR------------RCLDGF---WQRGGNASN---- 46

  Fly    74 AQWILRQPRVAV-FFGCVG-EDRYANILKEKAQAAGLDVHYQVKKDVPTGTC----------AVL 126
            ...:||.....| |||.:. .|.:..:|.:.:           |:::.|..|          :|:
  Fly    47 VSTVLRVLGCKVDFFGMLSRSDGFRVLLDDLS-----------KREIGTNDCPFTDRDPPFSSVI 100

  Fly   127 I---TGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAATAHAK 188
            :   :||...:..|    .::.....|:.|.   ::.:||.::. |.....|.::..:.:.....
  Fly   101 LAQDSGTRTIIHCN----KDYPQTTYEDFSK---INLSQYGWVH-FEARNTPHTLKMMQSIREYN 157

  Fly   189 QRPFL-MNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQW--PSGDLREIGKRLVAM 250
            ||... :.:|..|.:::.....|.| |...::|..|...|.     .|  |.....|:..:    
  Fly   158 QRTGQGIIISLDFETRYEQNQELCA-PCDFVVFSKELAGQL-----GWKTPRQSCEELASK---- 212

  Fly   251 EKKNPTRPRIAILTQGCDPVLLIQQDSV---------QEFPVTKLAVHEIVDTNGAGDAFVGGFL 306
                       |...|..||.:....|.         ..:.::.....::|||.||||:|:.||:
  Fly   213 -----------IPEGGPKPVFICPWGSAGAGAMDANGNYYEMSSYKQDKVVDTLGAGDSFMAGFI 266

  Fly   307 SQFVQG-KSLDVCIRCGNYAAGHIIKNPG 334
            ...::. :||...:...|..|.|.|...|
  Fly   267 YATLKARRSLAEAVDFANRVASHKITGFG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 69/353 (20%)
ribokinase_pfkB_like 14..343 CDD:294126 66/349 (19%)
CG7328NP_649181.1 Ketohexokinase 6..297 CDD:238914 69/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.