DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdenoK and CG7335

DIOPT Version :9

Sequence 1:NP_001287054.1 Gene:AdenoK / 39479 FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_649180.1 Gene:CG7335 / 40203 FlyBaseID:FBgn0036941 Length:372 Species:Drosophila melanogaster


Alignment Length:264 Identity:52/264 - (19%)
Similarity:91/264 - (34%) Gaps:57/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIY-GELVEGYQAEFLAGGSVQNSLRI 73
            ::..|:..||:..:|.|                     |:: |::....:..:..||...|...:
  Fly    33 VLAVGSCTLDMITIVDL---------------------PLFPGQVQRTTEGSWRRGGPAANICTV 76

  Fly    74 AQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDV-HYQVKKDVPTGTCAVLITGTHRSLCAN 137
              | .|......|.|.:...|....|....|:.|:|: |..:....|          .|||:   
  Fly    77 --W-RRLGLECEFLGVLSRVRAFESLLNGFQSQGIDISHCPLTNHRP----------AHRSI--- 125

  Fly   138 LAAANNFTIDHLE-EPSNKAL--------VDNAQYYYISGFFLTVNPPSIMQ-VAATAHAKQR-- 190
            :...|..|...|| ..:|:.|        ||..:|.:|  .|...||..::: |.|.....:|  
  Fly   126 IVQRNVDTRTMLEFANANQELTYQQFVGAVDYQKYSWI--HFECRNPVEMLRMVLAVIQFNERCP 188

  Fly   191 PFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEA--EAQAFAEAQQWPSGDLREIGKRLVAMEKK 253
            ...:.||....:......|:|::  ||.:|..:.  ....|...::.......|:.:.....||.
  Fly   189 ESRITLSVDLDNLRPATMLMASM--VDYVFARKTMMRTYCFMNGREVVWAIRNEMRRARTQWEKS 251

  Fly   254 NPTR 257
            .|.:
  Fly   252 QPKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 52/264 (20%)
ribokinase_pfkB_like 14..343 CDD:294126 52/260 (20%)
CG7335NP_649180.1 Ketohexokinase 32..357 CDD:238914 52/264 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.