DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdenoK and CG7551

DIOPT Version :9

Sequence 1:NP_001287054.1 Gene:AdenoK / 39479 FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster


Alignment Length:312 Identity:70/312 - (22%)
Similarity:129/312 - (41%) Gaps:54/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EDRHMPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAV-FFGCVGEDRYANILKEKAQAA 106
            |:.|..:.|    ||   ::.||...|:..    :|....|.| |.|.:.......:|.:..::.
  Fly    37 ENSHQKVIG----GY---WIRGGKASNNCT----VLANLGVKVEFLGMLSSWSVFQVLVDDLKSR 90

  Fly   107 GLDVHYQVKKDVPTGTCAVLITGTHRSLCANLAAANN----FTIDHLEEPSNKALVDNAQYYYIS 167
            |:.:......|......:|::|...::  .|:...||    .:||..    .|..::...:.:|.
  Fly    91 GIIIDNCPTCDQGAPFSSVILTKATKT--RNIVYCNNNFPYVSIDDF----RKLNLNQYGWIHIR 149

  Fly   168 GFFLTVNPPSIMQVAA-TAHAKQRPFLMNLSAPFISQF-YMAPLLAALPYVDIIFGNEAEAQAFA 230
            ..:...:.|.:..:.| .|:.|::   :.||..|.:.. .|.||:....|.  :|     ::..|
  Fly   150 ALYFDKSLPMVKDIEAYNANRKEK---IVLSMEFDNNLDDMWPLMDYCDYA--VF-----SKKLA 204

  Fly   231 EAQQWPSGD--LREIGKRLVAMEKKNPTRPRIAIL--TQGCDPVLLIQQDSVQEFPVTKLAVHE- 290
            :...|.|.:  ..::.:||......|..||.:.:|  .||.. :|.:..:      .|.:..|: 
  Fly   205 QPNGWVSLEDACMQLDERLRMRWGLNLKRPYVVVLWGDQGAG-ILDLNGN------FTHVKPHKP 262

  Fly   291 --IVDTNGAGDAFVGGFL-SQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSG 339
              |||..||||.|||.|: :.:::.:|:.|.:..||..|.:     .||.:|
  Fly   263 KRIVDALGAGDTFVGAFIYALYIRERSVSVAVDFGNRMASY-----KCTKNG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 70/312 (22%)
ribokinase_pfkB_like 14..343 CDD:294126 70/312 (22%)
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 70/312 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.