DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdenoK and CG13369

DIOPT Version :9

Sequence 1:NP_001287054.1 Gene:AdenoK / 39479 FlyBaseID:FBgn0036337 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster


Alignment Length:315 Identity:70/315 - (22%)
Similarity:112/315 - (35%) Gaps:55/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MPIYGELVEGYQAEFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDV- 110
            :|..||.:.|::.:...||...|....|   .||.........:|.|.:.:......:...::| 
  Fly    23 LPKAGETLHGHRFQIGYGGKGANQCVAA---ARQGSRTALVAKLGADTFGSDYLRHLREERVNVN 84

  Fly   111 HYQVKKDVPTGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNP 175
            |.:...:..||...:.::....:....:..||| .:...:..|.|||...|:.     ....:..
  Fly    85 HVEQLAEETTGVAQIAVSDGGENNIIIVVGANN-RLSSCDVSSAKALFQEAKV-----LVCQLET 143

  Fly   176 P--------------SIMQVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEA 226
            |              ||:. ||.|.|...|.|:.|::.|......|.|:..:|  ||  ||...|
  Fly   144 PVEATLTALRAFRGVSIVN-AAPAMADTPPELLQLASIFCVNESEAALMTQMP--DI--GNIEHA 203

  Fly   227 QAFAEAQQWPSGDLREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDS---VQEFPVTKLAV 288
            :             ..:||.:.|       .....|:|.|....:....||   .|......:..
  Fly   204 E-------------DAVGKLIAA-------GANTVIITLGKLGAVFGSADSKGVCQHVAAPSVPP 248

  Fly   289 HEIVDTNGAGDAFVGGFLSQFVQ--GKSLDVCIRCGNYAAGHIIKNPGCTYSGEP 341
            .::|||.||||||:|.......:  .:.|:..|......|...::.|| |.|..|
  Fly   249 EKVVDTTGAGDAFIGALAHNLARHPTRKLEEHIAAACAVASQSVQLPG-TQSSFP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdenoKNP_001287054.1 PTZ00247 10..343 CDD:240328 70/315 (22%)
ribokinase_pfkB_like 14..343 CDD:294126 70/315 (22%)
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 70/315 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456459
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.