DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL20 and rpl20

DIOPT Version :9

Sequence 1:NP_524051.1 Gene:mRpL20 / 39477 FlyBaseID:FBgn0036335 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_051082.1 Gene:rpl20 / 844735 -ID:- Length:117 Species:Arabidopsis thaliana


Alignment Length:91 Identity:27/91 - (29%)
Similarity:44/91 - (48%) Gaps:15/91 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RSRTR-NVYSFAIRSVH------------RALAYATKGRKLKKLDMAQLWSTRVEAGCQQYGV-- 81
            |.||: .:::.:.|..|            |||..|.:.|..:|.|..:||.||:.|...:.||  
plant    12 RRRTKLRLFASSFRGAHSRLTRTMTQQRIRALVSAHRDRGKRKRDFRRLWITRINAVIHEMGVFY 76

  Fly    82 GLETFKEGLARSDILLNKKVLSDLAI 107
            ....|...|.:..:|||:|:|:.:|:
plant    77 SYNEFIHNLYKKQLLLNRKILAQIAL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL20NP_524051.1 Ribosomal_L20 13..113 CDD:278860 27/91 (30%)
rpl20NP_051082.1 rpl20 1..117 CDD:214352 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1582185at2759
OrthoFinder 1 1.000 - - FOG0004486
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101985
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.