DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL20 and AT1G16740

DIOPT Version :9

Sequence 1:NP_524051.1 Gene:mRpL20 / 39477 FlyBaseID:FBgn0036335 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_173118.1 Gene:AT1G16740 / 838245 AraportID:AT1G16740 Length:126 Species:Arabidopsis thaliana


Alignment Length:102 Identity:46/102 - (45%)
Similarity:66/102 - (64%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KRRIFKLAAHYRSRTRNVYSFAIRSVHRALAYATKGRKLKKLDMAQLWSTRVEAGCQQYGVGLET 85
            |:.|||||..:|.|.:|....|...|.:||.|:.:.|:.||.:|..||..|:.||.:|:||....
plant     3 KKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQHGVNYGN 67

  Fly    86 FKEGLARSDILLNKKVLSDLAIWEPRSFEALVKISRE 122
            |..||.:.:|.||:||||:|::.||.||:|||.:||:
plant    68 FIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL20NP_524051.1 Ribosomal_L20 13..113 CDD:278860 39/91 (43%)
AT1G16740NP_173118.1 Ribosomal_L20 3..95 CDD:395363 39/91 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2868
eggNOG 1 0.900 - - E1_COG0292
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9941
Inparanoid 1 1.050 90 1.000 Inparanoid score I2277
OMA 1 1.010 - - QHG55210
OrthoDB 1 1.010 - - D1582185at2759
OrthoFinder 1 1.000 - - FOG0004486
OrthoInspector 1 1.000 - - oto4115
orthoMCL 1 0.900 - - OOG6_101985
Panther 1 1.100 - - LDO PTHR10986
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4868
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.