DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL20 and MRPL20

DIOPT Version :9

Sequence 1:NP_524051.1 Gene:mRpL20 / 39477 FlyBaseID:FBgn0036335 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_060441.2 Gene:MRPL20 / 55052 HGNCID:14478 Length:149 Species:Homo sapiens


Alignment Length:123 Identity:48/123 - (39%)
Similarity:73/123 - (59%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVFLNLPLLVRSRGPDEFWRKRRIFKLAAHYRSRTRNVYSFAIRSVHRALAYATKGRKLKKLDMA 65
            ||||...|.:|:|..|.::|.:.:.|.|.|:|.|....|..|:|:|.||....||.|.|||.:|.
Human     1 MVFLTAQLWLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMR 65

  Fly    66 QLWSTRVEAGCQQYGVGLETFKEGLARSDILLNKKVLSDLAIWEPRSFEALVKISRER 123
            .||..|:.|..|::|:........|.:..:.||:|||:||||:||::|::|..::..|
Human    66 TLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL20NP_524051.1 Ribosomal_L20 13..113 CDD:278860 39/99 (39%)
MRPL20NP_060441.2 Ribosomal_L20 13..118 CDD:197305 41/104 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152090
Domainoid 1 1.000 83 1.000 Domainoid score I8387
eggNOG 1 0.900 - - E1_COG0292
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9941
Inparanoid 1 1.050 96 1.000 Inparanoid score I5053
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55210
OrthoDB 1 1.010 - - D1582185at2759
OrthoFinder 1 1.000 - - FOG0004486
OrthoInspector 1 1.000 - - oto89775
orthoMCL 1 0.900 - - OOG6_101985
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5659
SonicParanoid 1 1.000 - - X4868
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.700

Return to query results.
Submit another query.