DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11267 and HSP10

DIOPT Version :9

Sequence 1:NP_648622.1 Gene:CG11267 / 39476 FlyBaseID:FBgn0036334 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_014663.1 Gene:HSP10 / 854185 SGDID:S000005546 Length:106 Species:Saccharomyces cerevisiae


Alignment Length:97 Identity:47/97 - (48%)
Similarity:71/97 - (73%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTRNASTGNHIPIGVKEGDR 70
            |.|:|::||:|:||.:|..||..|:.||||.|.|:.:..|:|||||..:|: ||.:...||.||:
Yeast     9 KSIVPLMDRVLVQRIKAQAKTASGLYLPEKNVEKLNQAEVVAVGPGFTDAN-GNKVVPQVKVGDQ 72

  Fly    71 VLLPEFGGTKVNLEGDQKELFLFRESDILAKL 102
            ||:|:|||:.:.| |:..|:.|||:::||||:
Yeast    73 VLIPQFGGSTIKL-GNDDEVILFRDAEILAKI 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11267NP_648622.1 Cpn10 7..102 CDD:197951 45/94 (48%)
HSP10NP_014663.1 cpn10 10..103 CDD:238197 45/94 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342082
Domainoid 1 1.000 91 1.000 Domainoid score I1751
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I1518
Isobase 1 0.950 - 0 Normalized mean entropy S576
OMA 1 1.010 - - QHG61845
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - otm46637
orthoMCL 1 0.900 - - OOG6_100490
Panther 1 1.100 - - LDO PTHR10772
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R196
SonicParanoid 1 1.000 - - X1667
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.