DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11267 and AT1G23100

DIOPT Version :9

Sequence 1:NP_648622.1 Gene:CG11267 / 39476 FlyBaseID:FBgn0036334 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_173723.1 Gene:AT1G23100 / 838918 AraportID:AT1G23100 Length:97 Species:Arabidopsis thaliana


Alignment Length:97 Identity:50/97 - (51%)
Similarity:71/97 - (73%) Gaps:4/97 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTRNASTGNHIPIGVKEGDR 70
            |::||.|:|:|:::....:||..||:||||: .::..|.|:|||||.|:.: ||.||:.|||||.
plant     3 KRLIPTLNRVLVEKILPPSKTVSGILLPEKS-SQLNSGRVIAVGPGARDRA-GNLIPVSVKEGDN 65

  Fly    71 VLLPEFGGTKVNLEGDQKELFLFRESDILAKL 102
            |||||||||:|.|  .:||..|:|:.||:|.|
plant    66 VLLPEFGGTQVKL--GEKEFLLYRDEDIMATL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11267NP_648622.1 Cpn10 7..102 CDD:197951 48/94 (51%)
AT1G23100NP_173723.1 Cpn10 4..95 CDD:197951 48/94 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2659
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2236
OMA 1 1.010 - - QHG61845
OrthoDB 1 1.010 - - D1580867at2759
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - mtm1197
orthoMCL 1 0.900 - - OOG6_100490
Panther 1 1.100 - - O PTHR10772
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.