DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11267 and AT3G60210

DIOPT Version :9

Sequence 1:NP_648622.1 Gene:CG11267 / 39476 FlyBaseID:FBgn0036334 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_191580.1 Gene:AT3G60210 / 825191 AraportID:AT3G60210 Length:138 Species:Arabidopsis thaliana


Alignment Length:97 Identity:31/97 - (31%)
Similarity:52/97 - (53%) Gaps:14/97 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIIPMLDRILIQRAEAL-TKTKGGIVLPEKAV--GKVLEGTVLAVGPGTRNASTGNHIPIGVKEG 68
            |::|..||:|: |.|.| .|:.||::||:.||  .:.|.|.|::||     :..|.     |:.|
plant    50 KVVPQADRVLV-RLEVLPEKSSGGVLLPKSAVKFERYLTGEVVSVG-----SEVGE-----VEPG 103

  Fly    69 DRVLLPEFGGTKVNLEGDQKELFLFRESDILA 100
            .:||..:....:|:...:..:....:|||:||
plant   104 KKVLFSDMSAYEVDFGTEDAKHCFCKESDLLA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11267NP_648622.1 Cpn10 7..102 CDD:197951 31/97 (32%)
AT3G60210NP_191580.1 Cpn10 50..137 CDD:395114 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.