DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11267 and CHL-CPN10

DIOPT Version :10

Sequence 1:NP_648622.1 Gene:CG11267 / 39476 FlyBaseID:FBgn0036334 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_566022.1 Gene:CHL-CPN10 / 819073 AraportID:AT2G44650 Length:139 Species:Arabidopsis thaliana


Alignment Length:99 Identity:32/99 - (32%)
Similarity:54/99 - (54%) Gaps:12/99 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KIIPMLDRILIQRAEALTKTKGGIVLPEKAV--GKVLEGTVLAVGPGTRNASTGNHIPIGVKEGD 69
            |::|..||:|::..:...|:.||::||:.||  .:.|.|.:::||     :..|..    |..|.
plant    51 KVVPQADRVLVRLEDLPIKSSGGVLLPKAAVKFERYLTGEIISVG-----SEVGQQ----VGPGK 106

  Fly    70 RVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE 103
            |||..:....:|:|..|.:..|. :|||:||.:|
plant   107 RVLFSDVSAYEVDLGTDARHCFC-KESDLLALVE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11267NP_648622.1 Cpn10 7..102 CDD:197951 31/96 (32%)
CHL-CPN10NP_566022.1 Cpn10 51..138 CDD:395114 31/96 (32%)

Return to query results.
Submit another query.