DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11267 and CG9920

DIOPT Version :9

Sequence 1:NP_648622.1 Gene:CG11267 / 39476 FlyBaseID:FBgn0036334 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_650333.1 Gene:CG9920 / 41712 FlyBaseID:FBgn0038200 Length:102 Species:Drosophila melanogaster


Alignment Length:103 Identity:66/103 - (64%)
Similarity:84/103 - (81%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTRNASTGNHIPIGV 65
            |:..|||:|||||||||||.|..|.|.|||:|||::|.|.::|.|:|||||.||.:...|:.:||
  Fly     1 MSNVIKKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAGAGHLSVGV 65

  Fly    66 KEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE 103
            |||||||||::|||||::: |::|..||||||||||||
  Fly    66 KEGDRVLLPKYGGTKVDMD-DKREYVLFRESDILAKLE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11267NP_648622.1 Cpn10 7..102 CDD:197951 60/94 (64%)
CG9920NP_650333.1 Cpn10 7..101 CDD:197951 60/94 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443418
Domainoid 1 1.000 90 1.000 Domainoid score I2659
eggNOG 1 0.900 - - E1_COG0234
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2236
Isobase 1 0.950 - 0 Normalized mean entropy S576
OMA 1 1.010 - - QHG61845
OrthoDB 1 1.010 - - D1580867at2759
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - otm26615
orthoMCL 1 0.900 - - OOG6_100490
Panther 1 1.100 - - P PTHR10772
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R196
SonicParanoid 1 1.000 - - X1667
1413.790

Return to query results.
Submit another query.