DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11267 and Hspe1

DIOPT Version :9

Sequence 1:NP_648622.1 Gene:CG11267 / 39476 FlyBaseID:FBgn0036334 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_032329.1 Gene:Hspe1 / 15528 MGIID:104680 Length:102 Species:Mus musculus


Alignment Length:98 Identity:57/98 - (58%)
Similarity:74/98 - (75%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTRNASTGNHIPIGVKEG 68
            |.:|.:|:.||:|::|:.|.|.|||||:||||:.||||:.||:|||.|.:..| |...|:.||.|
Mouse     5 AFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGGKGKS-GEIEPVSVKVG 68

  Fly    69 DRVLLPEFGGTKVNLEGDQKELFLFRESDILAK 101
            |:|||||:|||||.|  |.|:.||||:||||.|
Mouse    69 DKVLLPEYGGTKVVL--DDKDYFLFRDSDILGK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11267NP_648622.1 Cpn10 7..102 CDD:197951 56/95 (59%)
Hspe1NP_032329.1 cpn10 8..100 CDD:238197 56/95 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833698
Domainoid 1 1.000 105 1.000 Domainoid score I6639
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4876
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61845
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - mtm8770
orthoMCL 1 0.900 - - OOG6_100490
Panther 1 1.100 - - LDO PTHR10772
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R196
SonicParanoid 1 1.000 - - X1667
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.