DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11267 and HSPE1-MOB4

DIOPT Version :9

Sequence 1:NP_648622.1 Gene:CG11267 / 39476 FlyBaseID:FBgn0036334 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_001189414.1 Gene:HSPE1-MOB4 / 100529241 HGNCID:49184 Length:261 Species:Homo sapiens


Alignment Length:50 Identity:28/50 - (56%)
Similarity:41/50 - (82%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTR 53
            |.:|.:|:.||:|::|:.|.|.|||||:||||:.||||:.||:|||.|::
Human     5 AFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSK 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11267NP_648622.1 Cpn10 7..102 CDD:197951 27/46 (59%)
HSPE1-MOB4NP_001189414.1 cpn10 8..>57 CDD:238197 27/46 (59%)
Mob1_phocein 89..243 CDD:397617
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.