powered by:
Protein Alignment CG11267 and HSPE1-MOB4
DIOPT Version :9
Sequence 1: | NP_648622.1 |
Gene: | CG11267 / 39476 |
FlyBaseID: | FBgn0036334 |
Length: | 103 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189414.1 |
Gene: | HSPE1-MOB4 / 100529241 |
HGNCID: | 49184 |
Length: | 261 |
Species: | Homo sapiens |
Alignment Length: | 50 |
Identity: | 28/50 - (56%) |
Similarity: | 41/50 - (82%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 AIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTR 53
|.:|.:|:.||:|::|:.|.|.|||||:||||:.||||:.||:|||.|::
Human 5 AFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSK 54
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11267 | NP_648622.1 |
Cpn10 |
7..102 |
CDD:197951 |
27/46 (59%) |
HSPE1-MOB4 | NP_001189414.1 |
cpn10 |
8..>57 |
CDD:238197 |
27/46 (59%) |
Mob1_phocein |
89..243 |
CDD:397617 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0234 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.