DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICAL-like and Bmerb1

DIOPT Version :9

Sequence 1:NP_648621.1 Gene:MICAL-like / 39475 FlyBaseID:FBgn0036333 Length:1010 Species:Drosophila melanogaster
Sequence 2:NP_653101.1 Gene:Bmerb1 / 67254 MGIID:1914504 Length:203 Species:Mus musculus


Alignment Length:135 Identity:35/135 - (25%)
Similarity:69/135 - (51%) Gaps:16/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   836 EDLILQLFELVNEKNELFRRQAELMYLRRQHRLEQEQADIEHEIRVLMGQPEHNKTDSDKAHEEV 900
            |::.|::.::...:..|.||::||.::....:|.::..|::.|::.|:..||..||...|..|:.
Mouse    50 EEIELEMAKIQRLREVLVRRESELRFMMDDIQLCKDIMDLKQELQNLVAIPEKEKTKLQKQREDE 114

  Fly   901 LINRLVKVVEMRNEVIDSLETDRVREAREDMSIKNRLHI----------------YNSEREEPPA 949
            ||.::.::|:.|:.::|..|.:|:||..||..:.:.|.|                ...:.|.||:
Mouse   115 LIQKIHRLVQKRDFLVDDAEVERLREQEEDKEMADFLRIKLKPLDKVTKTSASSRAEKKAEPPPS 179

  Fly   950 HPRSA 954
            .|..|
Mouse   180 KPTVA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICAL-likeNP_648621.1 CH 14..111 CDD:278723
LIM_like_1 146..207 CDD:188784
DUF3585 778..933 CDD:288945 28/96 (29%)
Bmerb1NP_653101.1 DUF3585 <63..142 CDD:419985 24/78 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..184 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8264
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.