DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICAL-like and SMTN

DIOPT Version :9

Sequence 1:NP_648621.1 Gene:MICAL-like / 39475 FlyBaseID:FBgn0036333 Length:1010 Species:Drosophila melanogaster
Sequence 2:NP_001369571.1 Gene:SMTN / 6525 HGNCID:11126 Length:1009 Species:Homo sapiens


Alignment Length:97 Identity:39/97 - (40%)
Similarity:63/97 - (64%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WCRVVTQGYNGVKVENMTTSWRNGLAFCAIIHHFRPDLIDFDRLKADDIYENNDLAFTTAEKYLG 83
            |||..|:||..|.::|.::||.:|:||||::|:|.|:..|:.:|...:..:|.::||::||.:..
Human   902 WCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHAD 966

  Fly    84 IPALLDAADMVSYEVPDRLSILTYLSQFYKVL 115
            .|.|||..|||....||...:.||:.:||:.|
Human   967 CPQLLDTEDMVRLREPDWKCVYTYIQEFYRCL 998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICAL-likeNP_648621.1 CH 14..111 CDD:278723 36/91 (40%)
LIM_like_1 146..207 CDD:188784
DUF3585 778..933 CDD:288945
SMTNNP_001369571.1 Smoothelin 86..128 CDD:403640
Smoothelin 167..216 CDD:403640
Smoothelin 664..713 CDD:403640
CH_SMTNB 894..1005 CDD:409108 39/97 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.