DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICAL-like and si:ch211-195o20.7

DIOPT Version :9

Sequence 1:NP_648621.1 Gene:MICAL-like / 39475 FlyBaseID:FBgn0036333 Length:1010 Species:Drosophila melanogaster
Sequence 2:XP_009291345.1 Gene:si:ch211-195o20.7 / 564006 ZFINID:ZDB-GENE-131127-614 Length:484 Species:Danio rerio


Alignment Length:104 Identity:38/104 - (36%)
Similarity:59/104 - (56%) Gaps:1/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GTGTKALEYWCRVVTQGYNGVKVENMTTSWRNGLAFCAIIHHFRPDLIDFDRLKADDIYENNDLA 74
            |:...:|..||:..||||..:::.|.::.|.:|||||||.|.:.|..|.::||..::..||..||
Zfish   378 GSRRNSLLRWCQCRTQGYKNIEITNFSSCWVDGLAFCAIYHSYLPSHIPYNRLSPENKKENLTLA 442

  Fly    75 FTTAEKYLGIPALLDAADMVSYEVPDRLSILTYLSQFYK 113
            |.|.|.: ||...|...:|:..:.||...:|.|:...|:
Zfish   443 FQTGEGF-GISTSLTVEEMLKDDAPDWHRVLEYVESIYR 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICAL-likeNP_648621.1 CH 14..111 CDD:278723 36/96 (38%)
LIM_like_1 146..207 CDD:188784
DUF3585 778..933 CDD:288945
si:ch211-195o20.7XP_009291345.1 SPEC 143..>289 CDD:295325
CH 379..482 CDD:237981 37/103 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.