| Sequence 1: | NP_648621.1 | Gene: | MICAL-like / 39475 | FlyBaseID: | FBgn0036333 | Length: | 1010 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017951705.1 | Gene: | actn4 / 448522 | XenbaseID: | XB-GENE-494339 | Length: | 926 | Species: | Xenopus tropicalis |
| Alignment Length: | 41 | Identity: | 11/41 - (26%) |
|---|---|---|---|
| Similarity: | 17/41 - (41%) | Gaps: | 6/41 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 105 FFGIYDGHRRSRPVSGSVSSDDRMVLQAVSPET-VGSTAVV 144 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| MICAL-like | NP_648621.1 | CH_MICALL2 | 11..115 | CDD:409102 | 3/9 (33%) |
| LIM_like_1 | 146..207 | CDD:188784 | |||
| PTZ00449 | <411..727 | CDD:185628 | |||
| bMERB_dom | 785..933 | CDD:463467 | |||
| actn4 | XP_017951705.1 | CH_ACTN_rpt1 | 40..144 | CDD:409063 | 11/41 (27%) |
| CH_ACTN_rpt2 | 148..262 | CDD:409065 | |||
| SPEC | 289..510 | CDD:238103 | |||
| SPEC | 407..630 | CDD:238103 | |||
| SPEC | 522..747 | CDD:238103 | |||
| PTZ00184 | 752..>883 | CDD:185504 | |||
| EFhand_Ca_insen | 856..922 | CDD:430177 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||