DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICAL-like and T15B12.1

DIOPT Version :9

Sequence 1:NP_648621.1 Gene:MICAL-like / 39475 FlyBaseID:FBgn0036333 Length:1010 Species:Drosophila melanogaster
Sequence 2:NP_001367880.1 Gene:T15B12.1 / 188527 WormBaseID:WBGene00020530 Length:432 Species:Caenorhabditis elegans


Alignment Length:100 Identity:42/100 - (42%)
Similarity:57/100 - (56%) Gaps:2/100 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ALEYWCRVVTQGYNGVKVENMTTSWRNGLAFCAIIHHFRPDLIDFDRLKADDIYENNDLAFTTAE 79
            ||..|.:....||..|.|.|.::||.:|:||||:||.|.|:..||.:|..::...|.||||..||
 Worm   328 ALLRWIQNRVAGYPNVNVTNFSSSWADGMAFCALIHRFAPNSFDFSKLDPNNRRYNFDLAFKVAE 392

  Fly    80 KYLGIPALLDAADMVSY-EVPDRLSILTYLSQFYK 113
            .. ||..||:..||:.. :.||...:.||:..|||
 Worm   393 DN-GIFPLLEVDDMIMMGDRPDWKCVFTYVQSFYK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICAL-likeNP_648621.1 CH 14..111 CDD:278723 39/96 (41%)
LIM_like_1 146..207 CDD:188784
DUF3585 778..933 CDD:288945
T15B12.1NP_001367880.1 CH_SMTN-like 324..429 CDD:409049 41/99 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.