DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MICAL-like and LOC110437844

DIOPT Version :9

Sequence 1:NP_648621.1 Gene:MICAL-like / 39475 FlyBaseID:FBgn0036333 Length:1010 Species:Drosophila melanogaster
Sequence 2:XP_021326750.1 Gene:LOC110437844 / 110437844 -ID:- Length:255 Species:Danio rerio


Alignment Length:317 Identity:80/317 - (25%)
Similarity:126/317 - (39%) Gaps:80/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 SSISLPSANGPRKPLRASVGSP-----LRSEESSPTTSLSSITSPMRKKRQAPLPPIQTDFDSDP 645
            ::||..| |.|  ||.::..:|     |::.|:|..|:..:.|.|...|.::             
Zfish     2 NTISFHS-NVP--PLESNAKAPFGRVRLKALEASGETTAPAATVPSWMKEKS------------- 50

  Fly   646 GFSKLSDEQKALLHTQLKAPNLGDSTRRLIPLD-QSLLSDEATESSNYDESLSTSNADEEVNVVY 709
                        |...:..|:........:|.| :|:|...:...||.:.....:...|.|:...
Zfish    51 ------------LSRNVNTPSSNSKENNTVPSDWRSMLKPVSKPVSNIESKGLPARRTEAVSSPK 103

  Fly   710 RRILVPPTQPENTVERSKEDQKSPIVY--------NDFDR--NVSPLGHNKSTHGKWKRRKGPAP 764
            ..:   |.....|:..|....|:|...        ||...  .|||.|  ..||      |...|
Zfish   104 TSV---PASSTTTISISISSSKTPSTTPLKNGSKPNDSSSVFPVSPSG--TETH------KSHKP 157

  Fly   765 AVPIPPRKVLQRLPLQEIRHEFEIIAVQQLGLEKQGVILEKMIRDRCERSLDATDTDGPESAEVL 829
            ..          :|.::|:.|.:.|.:....|||:||.|||.:| :|       |.||.|  :.|
Zfish   158 GY----------IPKEDIQKELKEIEMNMNELEKKGVELEKQLR-QC-------DEDGEE--DTL 202

  Fly   830 TNSKEVEDLILQLFELVNEKNELFRRQAELMYLRRQHRLEQEQADIEHEIRVLMGQP 886
            .|     ||::..|.|:..|....||::||:|:.|...||:||..::.|:|.||.:|
Zfish   203 MN-----DLMVDWFTLIRNKQVYMRRESELVYIARTQDLEEEQPSVDAELRRLMEKP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MICAL-likeNP_648621.1 CH 14..111 CDD:278723
LIM_like_1 146..207 CDD:188784
DUF3585 778..933 CDD:288945 40/109 (37%)
LOC110437844XP_021326750.1 DUF3585 165..>254 CDD:314926 38/103 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D186776at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.