DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul6 and AT1G59790

DIOPT Version :9

Sequence 1:NP_648620.1 Gene:Cul6 / 39474 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_176188.1 Gene:AT1G59790 / 842272 AraportID:AT1G59790 Length:374 Species:Arabidopsis thaliana


Alignment Length:285 Identity:59/285 - (20%)
Similarity:102/285 - (35%) Gaps:77/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 MYSLLNKKMANFVTRCIYVQLR---DVDKLRTLKKEFQDHLNSKGIKLGFDFRPKCFKNDGSFEN 456
            :|....|.:.::..:.:...||   |.|.||.|.|.:.:|                         
plant    66 LYEKYRKVIEDYTIQTVLPSLREKHDEDMLRELVKRWNNH------------------------- 105

  Fly   457 FNLTLPDELQQAWKEFRIFYEARKLQSKAIIQLNNELSSGEITCHLNQSVYILEVSTLQMAVLML 521
                   ::...|......|..|.|..::.|.:.: |....:||.|: .||....||.:..|:.|
plant   106 -------KIMVKWLSKFFVYIDRHLVRRSKIPIPS-LDEVGLTCFLD-LVYCEMQSTAKEVVIAL 161

  Fly   522 FNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVNYIEINMDFT-----------NRK 575
            .:: ||            |.|.:..||.:....:|:|.......:...||.           :||
plant   162 IHK-ER------------EGEQIDRALVKNVLDIYVENGMGTLEKYEEDFESFMLQDTASYYSRK 213

  Fly   576 RRLFCNE-PLPRKMRKIEEKSEIELK--------IRRDKQVD----AAIVRIMKGQKQLEYSELI 627
            ...:..| ..|..|.|:||..::|.:        |...|.|:    ..:|.:.|.:.:.|:|...
plant   214 ASRWTEEDSCPDYMIKVEECLKMERERVTHYLHSITEPKLVEKIQNELLVMVTKNRLENEHSGFS 278

  Fly   628 SLVYEELKD---RVKPQVSFIKKRL 649
            :|:.::.|:   |:......|.|||
plant   279 ALLRDDKKNDLSRIYRLYLPIPKRL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 59/285 (21%)
CULLIN 362..500 CDD:214545 17/107 (16%)
Cullin_Nedd8 606..661 CDD:287520 12/51 (24%)
AT1G59790NP_176188.1 Cullin 47..>357 CDD:279260 59/285 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1040292at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.