DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul6 and Cacul1

DIOPT Version :9

Sequence 1:NP_648620.1 Gene:Cul6 / 39474 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:XP_006231740.1 Gene:Cacul1 / 365493 RGDID:1308127 Length:377 Species:Rattus norvegicus


Alignment Length:234 Identity:50/234 - (21%)
Similarity:92/234 - (39%) Gaps:51/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 KNDGSFENFNLTLPDELQQAWKEFRIFYEARKLQS---KAIIQLNNELSSGE----ITCHLNQSV 506
            |.||:.:......|.:.      ..|.||  ::.|   |.:.|.::|....:    ||.||.:..
  Rat   147 KLDGAIDQLLTQSPGDY------IPISYE--QIYSCVYKCVCQQHSEQMYSDLIKKITSHLERVS 203

  Fly   507 YILEVSTLQMAVLMLFNRHERFTEQELVTALGVELETLQEALKQIKFLVYIEVNKVNYIE--INM 569
            ..|:.|...:.:       |||.     .|||..:..||..:.     ::|.:||. |||  :|.
  Rat   204 KELQASPPDLYI-------ERFN-----IALGQYMGALQSIVP-----LFIYMNKF-YIETKLNR 250

  Fly   570 DFTNRKRRLFCNEPLPRK-----MRKIEEKSEIELKIRRDKQVDAAIVRIMKGQKQL--EYSELI 627
            |..:...:|| .|.:..|     |..:.|......::     ..:.:..|:||...|  |:.::.
  Rat   251 DLKDDLIKLF-TEHVAEKHIYSLMPLLLEAQSTPFQV-----TPSTMANIVKGLYTLRPEWVQMA 309

  Fly   628 SLVYEELKDRVKPQVSFIKKRL-DYLVEREYLERDNYYN 665
            ..::.:....:.|..  ::..| :|..:.:.|:|:...|
  Rat   310 PTLFSKFIPNILPPA--VESELSEYAAQDQKLQRELIQN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 50/234 (21%)
CULLIN 362..500 CDD:214545 12/57 (21%)
Cullin_Nedd8 606..661 CDD:287520 9/57 (16%)
Cacul1XP_006231740.1 Cullin 146..>264 CDD:279260 36/143 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.