DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cul6 and CACUL1

DIOPT Version :9

Sequence 1:NP_648620.1 Gene:Cul6 / 39474 FlyBaseID:FBgn0036332 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_722517.3 Gene:CACUL1 / 143384 HGNCID:23727 Length:369 Species:Homo sapiens


Alignment Length:249 Identity:49/249 - (19%)
Similarity:97/249 - (38%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRVKRISNYFDSMLPLIDNIL-QVVNQIFDDYTSFDGQKLMHLYHLIYKQCAAERNWNNPAQKN 64
            || |..|.:|..:..|.:|..: |::.|...||.....::   :|..:|| |.        .|::
Human   124 MN-VITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQ---IYSCVYK-CV--------CQQH 175

  Fly    65 GRSLYIVLSDCLMKRLKNIAWVMENQLDDNKPIRLIAKYLEHWVPYQRSCEKLNLACYHFNRNWV 129
            ...:|   || |:|::.|....:..:|..:.|...|.::......|..:.:.:.....:.|:.::
Human   176 SEQMY---SD-LIKKITNHLERVSKELQASPPDLYIERFNIALGQYMGALQSIVPLFIYMNKFYI 236

  Fly   130 E---RERLKGDKETYPIYRLAMISWKELVFEPSVTILAAIRLILSQMPREYNKSLEYQVYQVLQS 191
            |   ...||.|     :.:|    :.|.|.|..:..|..:.|.....|.:...|....:.:.|.:
Human   237 ETKLNRDLKDD-----LIKL----FTEHVAEKHIYSLMPLLLEAQSTPFQVTPSTMANIVKGLYT 292

  Fly   192 I----VELYAN--DKYQDVSLPSRIDKIFTEKVMDFYKSTTLHEFQKIVVSNDY 239
            :    |::...  .|:....||..::...:|......|      ||:.::.|.:
Human   293 LRPEWVQMAPTLFSKFIPNILPPAVESELSEYAAQDQK------FQRELIQNGF 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cul6NP_648620.1 COG5647 25..670 CDD:227934 41/224 (18%)
CULLIN 362..500 CDD:214545
Cullin_Nedd8 606..661 CDD:287520
CACUL1NP_722517.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Cullin 138..>256 CDD:279260 28/142 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.