DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11263 and EXD1

DIOPT Version :10

Sequence 1:NP_648618.1 Gene:CG11263 / 39472 FlyBaseID:FBgn0036330 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001273370.1 Gene:EXD1 / 161829 HGNCID:28507 Length:572 Species:Homo sapiens


Alignment Length:140 Identity:30/140 - (21%)
Similarity:53/140 - (37%) Gaps:36/140 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RQKYGERQDTNASWLSDDRTIKPKLPSCGFRSMLPLNELLDVNGGFMVNGEVKIVAEVGVLEVVR 95
            |::|......:.....:|...:..:|.|    :|.|.:::|   |:  |.:.|:           
Human    41 RRRYYRHSLIHLQGAIEDWNKESSMPCC----VLQLGDIID---GY--NAQYKV----------- 85

  Fly    96 KSDVLVETSLVMESIDVNGFQVLPSQVESVKSLFEKHPDIASKFRPKNPHLRTTSLNSLLSLTEI 160
             |:..:|  |||     |.||:|...|.......|       .:.....:|.::.|||.....:|
Human    86 -SEKSLE--LVM-----NTFQMLKVPVHHTWGNHE-------FYNFSRDYLASSKLNSKFLEDQI 135

  Fly   161 LCHCQ-SPEE 169
            ..|.: :|.|
Human   136 AQHPETTPSE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11263NP_648618.1 DnaQ_like_exo 54..227 CDD:447876 27/117 (23%)
EXD1NP_001273370.1 Egl_like_exo 147..345 CDD:99851
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.