DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11262 and CG33934

DIOPT Version :9

Sequence 1:NP_648617.2 Gene:CG11262 / 39471 FlyBaseID:FBgn0036329 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001163660.1 Gene:CG33934 / 3772159 FlyBaseID:FBgn0064119 Length:556 Species:Drosophila melanogaster


Alignment Length:511 Identity:96/511 - (18%)
Similarity:175/511 - (34%) Gaps:140/511 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SVYPLVT---------ENGVLYAALLLIG----FYI--LIVFELTDRTFAALMMATTGIAILTAL 252
            ::.||:|         ||.:.:..:.|:.    |:|  .|...|| ..|..:.:...||.     
  Fly    28 AMIPLITLPIMIYGVLENNLAFQCMYLVANMALFWITEAIPLYLT-ALFPVVFLPLFGIL----- 86

  Fly   253 GNRPTLETIISWIDFETLILLLGMMILVAIMSETGVFDWMAVLAYRISKGNPWPMLLLLSSITAI 317
                |.|.:.|:...:|:::.:|.:::...:..:.:...:|:....|...:|..:...|..:|..
  Fly    87 ----TSEKVCSFYFSDTVVMFIGGLLIALAIEYSNLHQRIALNTILIVGCSPRRLHFGLVMVTCF 147

  Fly   318 MSCMLDNVTMLLLMAPIAIRLCEAMAVQTPLVLIVVVMYSNIGGTLTPVGDPPN----------- 371
            :|..:.|.....:|.||...:...|..|.     :..:|..........||||:           
  Fly   148 ISLWISNSAATAMMCPIVKAVLNEMETQN-----IFAIYKTQEEEPVEEGDPPHPSTISMAFYFG 207

  Fly   372 -----------VIIATNSEVISAG------------VDFLDFTIHMLPGVLLAAVAGYAVMYVTM 413
                       .:|.|.:.:...|            :||..|..:.:|.|:|      .::::| 
  Fly   208 IAYSSSIGGCGTLIGTGTNLTYKGLYDTRFPNSDEKIDFPIFMAYSVPFVVL------VLIFLT- 265

  Fly   414 RKSLFKLEEQQLELAAERENSRRRSSADITARAEEMRIRQPTGRQLLKPAENYFQTLAHLEAHHR 478
               .|.|:...:.|.  |.||  :...::...||...:.:...:|  :.||     |..:..|. 
  Fly   266 ---YFSLQVTHMGLF--RPNS--KIGQEVKKGAESQDVVKDVIKQ--RKAE-----LGPMSCHE- 315

  Fly   479 IRDKTLLIKCLFTLCFVIIFFLLHSLPFMHGATLGWVAIL-------------AAFLLLILAKM- 529
                 :.:..||.|   :||.|....|   |...||...|             |..||..|... 
  Fly   316 -----IQVGLLFVL---MIFLLFTRKP---GFFPGWADFLNAKAIGSGPPVFFATILLFALPTQY 369

  Fly   530 --------------NDIEAILDQV------EWSALLFLAALFVLTEAVDKLGFIRWLCDLTVKVI 574
                          ..::|.|..|      .:.....|...|.|.|.....|..:.|.:   .:.
  Fly   370 TFFKYCCGKAPFPGQTLDACLSWVYCQKYTPFGLAFLLGGGFALAEGSRVSGMAKMLGE---SLA 431

  Fly   575 MSVEERYQTTVAILIIIWMSAILAAFVGNVPVTTMLLRLNIELHRNDAISVPLTPL 630
            .:.|......:::.|||  |....||..||.:..:|:.:..|:    |:::.:.|:
  Fly   432 FAGEMHSVLVISMCIII--SLFCTAFASNVAICNILIPIFSEM----ALAIEVHPM 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11262NP_648617.2 ArsB 216..692 CDD:223983 91/489 (19%)
P_permease 220..691 CDD:238536 91/485 (19%)
CG33934NP_001163660.1 dass 45..540 CDD:273267 92/494 (19%)
ArsB_NhaD_permease 52..524 CDD:304373 91/487 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448697
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.