DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and MDH1

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_012838.1 Gene:MDH1 / 853777 SGDID:S000001568 Length:334 Species:Saccharomyces cerevisiae


Alignment Length:313 Identity:148/313 - (47%)
Similarity:211/313 - (67%) Gaps:8/313 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPF--EGKNGLKK 91
            ||.|:|:.||||||||||||.|.:::.|.|||:|...||..|||||.|.:.|..|  |..:||..
Yeast    19 KVTVLGAGGGIGQPLSLLLKLNHKVTDLRLYDLKGAKGVATDLSHIPTNSVVKGFTPEEPDGLNN 83

  Fly    92 AMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPINVIVPIVAT 156
            |:...|:|:||||:||||||.|:||..:|||:..::|.|.:|..|.|.:..|:||:|..|||||.
Yeast    84 ALKDTDMVLIPAGVPRKPGMTRDDLFAINASIVRDLAAATAESAPNAAILVISNPVNSTVPIVAQ 148

  Fly   157 ILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTILPILSQCDPPFKG 221
            :||.||.|:|.:||||||||.:||..|::::.|.||.:..:.|||||:|.||:|::||.:.....
Yeast   149 VLKNKGVYNPKKLFGVTTLDSIRAARFISEVENTDPTQERVNVIGGHSGITIIPLISQTNHKLMS 213

  Fly   222 TDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKGIKGSKDECIVECAYVESD 286
            .||..| ||.|||..|.|||.||:|.||||||||.|..:|.::::.|.||.:|  ::|.::|:|.
Yeast   214 DDKRHE-LIHRIQFGGDEVVKAKNGAGSATLSMAHAGAKFANAVLSGFKGERD--VIEPSFVDSP 275

  Fly   287 VTEA---QFFATPLILGPQGVKENTGLPDLDDEERKALNGMLPILKESIAKGI 336
            :.::   :|||:|:.|||.|:::...:.:|..||.:.|......||::|.||:
Yeast   276 LFKSEGIEFFASPVTLGPDGIEKIHPIGELSSEEEEMLQKCKETLKKNIEKGV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 148/313 (47%)
MDH_euk_gproteo 29..345 CDD:130833 148/313 (47%)
MDH1NP_012838.1 MDH_glyoxysomal_mitochondrial 18..331 CDD:133422 148/313 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I1005
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 315 1.000 Inparanoid score I464
Isobase 1 0.950 - 0 Normalized mean entropy S410
OMA 1 1.010 - - QHG56560
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 1 1.000 - - otm46892
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1106
TreeFam 1 0.960 - -
1110.880

Return to query results.
Submit another query.