DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and mMDH1

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_564625.1 Gene:mMDH1 / 841757 AraportID:AT1G53240 Length:341 Species:Arabidopsis thaliana


Alignment Length:326 Identity:162/326 - (49%)
Similarity:216/326 - (66%) Gaps:13/326 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GNLPPKVQQLGYINRGLKVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINT 76
            |::|.:           |||::|:.|||||||:||:|.||.:|:||||||.||.||..|:.||||
plant    25 GSVPER-----------KVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINT 78

  Fly    77 RASVCPFEGKNGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLA 141
            |:.|..:.|.:.|.||::.||:|:||||:||||||.|:||.::||.:...:..|.::.||.|::.
plant    79 RSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALIN 143

  Fly   142 FITNPINVIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGR 206
            .|:||:|..|||.|.|.|..|.||..:||||||||||||:||.|...||...:||:||||||.|.
plant   144 MISNPVNSTVPIAAEIFKKAGMYDEKKLFGVTTLDVVRARTFYAGKANVPVAEVNVPVIGGHAGV 208

  Fly   207 TILPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKGIKG 271
            ||||:.||..|....:.....||.:|.|:.|||||.||.|.||||||||:|...|..:.:||:.|
plant   209 TILPLFSQATPQANLSSDILTALTKRTQDGGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNG 273

  Fly   272 SKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLPDLDDEERKALNGMLPILKESIAKGI 336
            ..|  ::||:||:|.:||..|||:.:.||..||:|...|..|.|.|::.|..:.|.||.||.||:
plant   274 VPD--VIECSYVQSTITELPFFASKVRLGKNGVEEVLDLGPLSDFEKEGLEALKPELKSSIEKGV 336

  Fly   337 K 337
            |
plant   337 K 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 159/308 (52%)
MDH_euk_gproteo 29..345 CDD:130833 160/309 (52%)
mMDH1NP_564625.1 PLN00106 12..334 CDD:215058 159/321 (50%)
MDH_glyoxysomal_mitochondrial 31..339 CDD:133422 160/309 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56560
OrthoDB 1 1.010 - - D976445at2759
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1106
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.