DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and PMDH2

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001119199.1 Gene:PMDH2 / 830825 AraportID:AT5G09660 Length:363 Species:Arabidopsis thaliana


Alignment Length:294 Identity:143/294 - (48%)
Similarity:196/294 - (66%) Gaps:16/294 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRLLSHVGNLPPKVQQLGYI-----------NRGLKVAVVGSVGGIGQPLSLLLKHNPQISTLSL 58
            :|:.:|   |.|:::....:           |.|.|||::|:.|||||.||||:|.||.:|.|.|
plant    12 ARISAH---LTPQMEAKNSVIGRENCRAKGGNPGFKVAILGAAGGIGQSLSLLMKMNPLVSLLHL 73

  Fly    59 YDIKNTTGVGVDLSHINTRASVCPFEGKNGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASV 123
            ||:.|..||..|:||::|.|.|..|.|...|:.|:...|:|:||||:||||||.|:||..:||.:
plant    74 YDVVNAPGVTADVSHMDTGAVVRGFLGAKQLEDALTGMDLVIIPAGIPRKPGMTRDDLFKINAGI 138

  Fly   124 ACEVAFAASEVCPGAMLAFITNPINVIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADIL 188
            ...:....::.||.|::..|:||:|..|||.|.:.|..|||||.:|.|||||||.||.||||::|
plant   139 VKTLCEGVAKCCPNAIVNLISNPVNSTVPIAAEVFKKAGTYDPKKLLGVTTLDVARANTFVAEVL 203

  Fly   189 NVDPQKVNIPVIGGHTGRTILPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLS 253
            .:||::|::||:|||.|.||||:|||..||...|.:|.|.|..||||.|||||.||.|.||||||
plant   204 GLDPREVDVPVVGGHAGVTILPLLSQVKPPSSFTPQEIEYLTNRIQNGGTEVVEAKAGAGSATLS 268

  Fly   254 MAFAATQFVSSLIKGIKGSKDECIVECAYVESDV 287
            ||:||.:|..:.::|::|  |..:|||::|.|.|
plant   269 MAYAAAKFADACLRGLRG--DANVVECSFVASQV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 137/260 (53%)
MDH_euk_gproteo 29..345 CDD:130833 137/259 (53%)
PMDH2NP_001119199.1 PLN00106 31..300 CDD:215058 138/270 (51%)
MDH_glyoxysomal_mitochondrial 43..301 CDD:133422 137/260 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56560
OrthoDB 1 1.010 - - D976445at2759
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.