DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and AT3G53910

DIOPT Version :10

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_190959.1 Gene:AT3G53910 / 824558 AraportID:AT3G53910 Length:108 Species:Arabidopsis thaliana


Alignment Length:85 Identity:28/85 - (32%)
Similarity:48/85 - (56%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 FAATQFVSSLIKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKE--NTGLPDLDDEER 318
            :|...|:.|||:.:.|  |:.:.:.|:|.|.|||..:|||...:|.:.::|  ::.|..|...|.
plant     9 YAMISFLKSLIRALDG--DDDVFDFAFVASSVTELPYFATRTKIGKKRIEEVIDSDLQGLAKYEE 71

  Fly   319 KALNGMLPILKESIAKGIKL 338
            :|:..:.|.:|.:|.|.|.|
plant    72 RAIKAIKPRVKVTIEKDITL 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 26/82 (32%)
AT3G53910NP_190959.1 PLN00106 <9..87 CDD:215058 25/79 (32%)

Return to query results.
Submit another query.