DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and mMDH2

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_188120.1 Gene:mMDH2 / 820731 AraportID:AT3G15020 Length:341 Species:Arabidopsis thaliana


Alignment Length:324 Identity:162/324 - (50%)
Similarity:217/324 - (66%) Gaps:10/324 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GYINRGL--------KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRA 78
            |.:.||.        ||.::|:.||||||||||:|.||.:|:||||||.||.||..|:.|||||:
plant    16 GLLRRGFASESVPDRKVVILGAAGGIGQPLSLLMKLNPLVSSLSLYDIANTPGVAADVGHINTRS 80

  Fly    79 SVCPFEGKNGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFI 143
            .|..:.|.:.|.||::.||:|:||||:||||||.|:||.::||.:...::.|.::.||.|::..|
plant    81 QVSGYMGDDDLGKALEGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLSIAIAKYCPQALVNMI 145

  Fly   144 TNPINVIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTI 208
            :||:|..|||.|.|.|..||||..:||||||||||||:||.|...:|:..:||:||:|||.|.||
plant   146 SNPVNSTVPIAAEIFKKAGTYDEKKLFGVTTLDVVRARTFYAGKSDVNVAEVNVPVVGGHAGITI 210

  Fly   209 LPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKGIKGSK 273
            ||:.||..|....:|....||.:|.|:.|||||.||.|.||||||||:|...|..:.:||:.|..
plant   211 LPLFSQASPQANLSDDLIRALTKRTQDGGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNGVP 275

  Fly   274 DECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLPDLDDEERKALNGMLPILKESIAKGIK 337
            :  :|||::|:|.:||..|||:.:.||..||:|...|..|.|.|::.|..:...||.||.||||
plant   276 N--VVECSFVQSTITELPFFASKVRLGKNGVEEVLDLGPLSDFEKEGLEALKAELKSSIEKGIK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 157/316 (50%)
MDH_euk_gproteo 29..345 CDD:130833 159/309 (51%)
mMDH2NP_188120.1 PLN00106 14..334 CDD:215058 158/319 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56560
OrthoDB 1 1.010 - - D976445at2759
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.