DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and PMDH1

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_179863.1 Gene:PMDH1 / 816808 AraportID:AT2G22780 Length:354 Species:Arabidopsis thaliana


Alignment Length:344 Identity:166/344 - (48%)
Similarity:229/344 - (66%) Gaps:14/344 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRLLSHVG--NLPPKVQQLGYINR----------GLKVAVVGSVGGIGQPLSLLLKHNPQISTLS 57
            :|:.:|:.  ||..::.....:||          |.|||::|:.|||||||::|:|.||.:|.|.
plant     8 ARISAHLNPPNLHNQIADGSGLNRVACRAKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLH 72

  Fly    58 LYDIKNTTGVGVDLSHINTRASVCPFEGKNGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNAS 122
            |||:.|..||..|:||::|.|.|..|.|:..|::|:...|:|:||||:||||||.|:||.::||.
plant    73 LYDVANAPGVTADISHMDTSAVVRGFLGQPQLEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAG 137

  Fly   123 VACEVAFAASEVCPGAMLAFITNPINVIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADI 187
            :...::.|.::.||.|::..|:||:|..|||.|.:.|..||:||.:|.|||.||||||.||||::
plant   138 IVRTLSEAIAKCCPKAIVNIISNPVNSTVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEV 202

  Fly   188 LNVDPQKVNIPVIGGHTGRTILPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATL 252
            :::||::|.:||:|||.|.||||:|||..||...|.||.|.|..||||.|||||.||.|.|||||
plant   203 MSLDPREVEVPVVGGHAGVTILPLLSQVKPPCSFTQKEIEYLTDRIQNGGTEVVEAKAGAGSATL 267

  Fly   253 SMAFAATQFVSSLIKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLPDLDDEE 317
            |||:||.:|..:.::|::|  |..|||||||.|.|||..|||:.:.||..|:.|..||..|::.|
plant   268 SMAYAAVEFADACLRGLRG--DANIVECAYVASHVTELPFFASKVRLGRCGIDEVYGLGPLNEYE 330

  Fly   318 RKALNGMLPILKESIAKGI 336
            |..|......|..||.||:
plant   331 RMGLEKAKKELSVSIHKGV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 159/309 (51%)
MDH_euk_gproteo 29..345 CDD:130833 159/308 (52%)
PMDH1NP_179863.1 PLN00106 33..347 CDD:215058 158/315 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56560
OrthoDB 1 1.010 - - D976445at2759
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.