DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and Uevld

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_008757683.1 Gene:Uevld / 691172 RGDID:1587416 Length:470 Species:Rattus norvegicus


Alignment Length:344 Identity:76/344 - (22%)
Similarity:115/344 - (33%) Gaps:73/344 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SHVGNLPPKVQQLGYINRGLKVAVVGSVGGIGQPLSLL-LKHNPQISTLSLYDIKNTTGVGV--D 70
            :|...:|.|:..:|..:.|:...:..|..||...|.|| |.......|:.| ||.|...|.:  |
  Rat   176 NHENKIPNKITVVGSGDLGIACTLAISAKGIADKLLLLDLSDGTNQGTMDL-DIFNLPNVEISKD 239

  Fly    71 LSHINTRASVCPFEGKNGLKKAMDKADIVVIPAGLPRKPGMKREDL--VDVNASVACEVAFAASE 133
            ||                   |...:.:|:..|   ...|.....|  |..|..:...:..|...
  Rat   240 LS-------------------ASAHSKVVIFTA---NSLGGSESYLHAVQSNVDMFRALVPALGH 282

  Fly   134 VCPGAMLAFITNPINVIVPIVATILKAKGTYDPNRLFGV-TTLDVVRAQTFVADILNVDPQKVNI 197
            ....|:|...:.|    |.|::.:.....|:...|:.|: ..||..|.|..::.:|........:
  Rat   283 YSQHAVLLVASQP----VEIMSYVTWKLSTFPAARVMGIGCNLDSQRLQYIISSVLKAQTSGKEV 343

  Fly   198 PVIG-----------GHTGRTILPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSAT 251
            .|:|           |..|.......:|......|..|.:.   ||..:.|..|.:..|     |
  Rat   344 WVVGEQGENKVCSWSGQDGVMSPSSQAQLSSRAMGLLKVKG---QRSWSVGLSVADLLD-----T 400

  Fly   252 LSMAFAATQFVSSLIKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKE--NTGLPDLD 314
            :.........||:|.||..|..:|.               |.:.|.|||..||.|  .|...|..
  Rat   401 IINNKKKVHSVSTLAKGYYGLDNEV---------------FLSLPCILGTSGVSEVLKTAAEDAV 450

  Fly   315 DE----ERKALNGMLPILK 329
            .|    ...:::|:...||
  Rat   451 TEALQTSASSIHGLQQQLK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 71/325 (22%)
MDH_euk_gproteo 29..345 CDD:130833 71/324 (22%)
UevldXP_008757683.1 UEV 21..138 CDD:283415
NADB_Rossmann 180..467 CDD:304358 73/336 (22%)
L-LDH-NAD 187..461 CDD:273796 70/323 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.