DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and Uevld

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001035785.1 Gene:Uevld / 54122 MGIID:1860490 Length:471 Species:Mus musculus


Alignment Length:378 Identity:72/378 - (19%)
Similarity:125/378 - (33%) Gaps:158/378 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGI------GQPL-SLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPFEGK 86
            |.|:||.:..:      ..|| |:...:..|...|..|..|.|.||    |.||:|.      ..
Mouse   121 KSAIVGLIKEMIAKFQEELPLYSIPSSNEAQQVDLLAYITKITEGV----SDINSRG------WT 175

  Fly    87 NGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPINVIV 151
            |...|.::|  |.|:.:|          ||     .:||.:|.:|..:....:|..:::.:    
Mouse   176 NHENKILNK--ITVVGSG----------DL-----GIACTLAISAKGIADKLLLLDLSDGM---- 219

  Fly   152 PIVATILKAKGTYDPNRLFGVTTLDV---------VRAQTFVADIL------------NVDPQKV 195
                    ::||.|.: :|.:..:::         .:...|.|:.|            |||..:.
Mouse   220 --------SQGTMDLD-IFNLPNVEISKDLSASAHSKVVIFTANSLGGSESYLHAVQSNVDMFRA 275

  Fly   196 NIPVIGGHTGRTILPILSQCDPPFK--------------------GTDKEREAL------IQRIQ 234
            .:|.:|.::...:|.:.||   |.:                    |.:.:.:.|      :.::|
Mouse   276 LVPALGHYSQHAVLLVASQ---PVEIMSYVTWKLSTFPATRVVGIGCNLDSQRLQYIITSVLKVQ 337

  Fly   235 NAGTEV-------------VNAKDGL--------------------GSATLSMAFAATQF----- 261
            .:|.||             .:.:||:                    |..:.|:..:....     
Mouse   338 TSGKEVWVVGEQGENKVCSWSGRDGVLSPSSQAQLSSRAMELLKVKGQRSWSVGLSVADLVDTII 402

  Fly   262 --------VSSLIKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKE 306
                    ||:|.||..|..:|.               |.:.|.|||..||.|
Mouse   403 NNKRKVHSVSTLAKGYYGLDNEV---------------FLSLPCILGTGGVSE 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 72/378 (19%)
MDH_euk_gproteo 29..345 CDD:130833 72/378 (19%)
UevldNP_001035785.1 UEV 21..138 CDD:283415 4/16 (25%)
PLN02602 177..471 CDD:178212 53/312 (17%)
NADB_Rossmann 183..468 CDD:304358 52/306 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.