DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and uevld

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001007958.1 Gene:uevld / 493332 XenbaseID:XB-GENE-5786365 Length:476 Species:Xenopus tropicalis


Alignment Length:290 Identity:50/290 - (17%)
Similarity:106/290 - (36%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPFEGKNGLKKAMDKADIV 99
            :.||....|.:....|.|::.    |.....|..:.:..:|:.::...:.|       :.::::.
 Frog   214 AAGGAAADLEIFSLPNVQVTK----DFSAIAGSAIVIVTVNSWSNSQSYVG-------VLQSNVE 267

  Fly   100 VIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPINVIVPIVATILKAKGTY 164
            ::...||                       |.:..||..:|...:.|:.::.  .|| .|..| :
 Frog   268 LLRGILP-----------------------AVAHHCPKCLLLVASQPVEIMT--YAT-WKLSG-F 305

  Fly   165 DPNRLFGV-TTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTILPILSQCDPPFKGTDKEREA 228
            ..||:.|: ..||..|.:..:..:.:.:.......:||..:...:    :....|....:::...
 Frog   306 PHNRVLGIGCNLDSGRFRHVIEKLADSEEGAQGAWIIGEQSDNKV----AVWGAPDSSANRQTPC 366

  Fly   229 LI------QRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKGIKGSKDECIVECAYVESDV 287
            .:      :::.:...|::..|   |..:.|:..:......:|::. ||........|. .:..|
 Frog   367 KLYPKIFQEQLTSRALEILKGK---GQRSWSVGLSVADITDTLVQN-KGKVHSVSALCK-GQFGV 426

  Fly   288 TEAQFFATPLILGPQGVKENTG-LPDLDDE 316
            .|..|.:.|.:||..||   || :..|.||
 Frog   427 QEEVFLSIPCVLGSAGV---TGAVQTLQDE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 50/290 (17%)
MDH_euk_gproteo 29..345 CDD:130833 50/290 (17%)
uevldNP_001007958.1 UEV 21..138 CDD:283415
PLN02602 166..476 CDD:178212 50/290 (17%)
NADB_Rossmann 174..473 CDD:304358 50/290 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.