DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and uevld

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001003619.1 Gene:uevld / 445225 ZFINID:ZDB-GENE-040801-138 Length:471 Species:Danio rerio


Alignment Length:382 Identity:84/382 - (21%)
Similarity:141/382 - (36%) Gaps:117/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRLLSHVGNLPPKVQQLGYINRG-------LKVAVVGSVG-GIGQPLSLLLKHNPQISTLSLYDI 61
            |.||.:|.||.        |..|       :||:|:|... ||...||::.|  ..:..|.|.||
Zfish   153 SNLLDYVSNLT--------ITEGGNRPDQEVKVSVIGGGDLGIAAVLSIMAK--SCVDKLVLIDI 207

  Fly    62 --KNTTGVGVDLSHINTRASVCPFEGKNGLKKAMDKADIVVIPAGLPRKPGMKRE----DLVDVN 120
              .:|.|..:||...    |:...|....| .|...:.::||.|.     ....|    .:|..|
Zfish   208 PENSTKGGTMDLEIF----SLPKVEVSKDL-SASAGSKVLVITAN-----AWSDEQSYLSVVQTN 262

  Fly   121 ASVACEVAFAASEVCPGAMLAFITNPINVIVPIV---ATILKAKGTYDPNRLFGVTTLDVVRAQT 182
            ..:...:....:::.|.|:|...:.|::|:..:.   :.:|       |.::.||.         
Zfish   263 VDMYRGIIPRLAQLSPNAVLVIASQPVDVMTHVAWRQSHLL-------PTQVIGVG--------- 311

  Fly   183 FVADILNVDPQK----VNIPVIGGHTGRTILPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNA 243
                 .|:|.|:    :||.::..:||:....|         |...|.:..:......||:.:.|
Zfish   312 -----CNLDSQRLSHIINISLVANNTGKQAWVI---------GELSENKVAVWGNMGPGTDQLQA 362

  Fly   244 KDGLGSAT---LSMAFAATQFVSSLIKGIKGSKD------------ECIVECAYVESDVTEAQ-- 291
            ...:.::|   :..||       .:||| :|.:.            ..:.....|.|..|.|:  
Zfish   363 LTPVSNSTKPLMDRAF-------EMIKG-RGQRSWSVGLSIADITHSIVTNQKKVHSVTTLAEGW 419

  Fly   292 -------FFATPLILGPQGVKENTGLPDL---DDEERKALNGMLPILKESIAKGIKL 338
                   |.:.|.|||..|   :|.||.:   .::|.|        |:||:|..:.|
Zfish   420 GGIGSKVFLSLPCILGETG---STRLPGVALGSEDEMK--------LRESVACQVNL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 75/349 (21%)
MDH_euk_gproteo 29..345 CDD:130833 76/351 (22%)
uevldNP_001003619.1 UEV 21..139 CDD:283415
LDH_1 172..468 CDD:133429 76/355 (21%)
L-LDH-NAD 179..460 CDD:273796 72/341 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.