DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and ldhbb

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_005170715.1 Gene:ldhbb / 436747 ZFINID:ZDB-GENE-040718-176 Length:355 Species:Danio rerio


Alignment Length:304 Identity:79/304 - (25%)
Similarity:133/304 - (43%) Gaps:66/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQ--PLSLLLKHNPQISTLSLYDI--KNTTGVGVDLSH----INTRASVCPFEG 85
            ||.||| ||.:|.  .:|:||:.  ....|:|.|:  ....|..:||.|    :.|...|   .|
Zfish    44 KVTVVG-VGQVGMACAVSVLLRE--LADELALVDVVEDKLKGEMMDLQHGSLFLKTPKIV---SG 102

  Fly    86 KNGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPINVI 150
            |:....|..:  |||:.||:.::.|..|.:||..|.::...:.....:..|..:|..::||::|:
Zfish   103 KDYSVTANSR--IVVVTAGVRQQEGESRLNLVQRNVNIFKHIIPQIVKYSPNCILIVVSNPVDVL 165

  Fly   151 VPIVATILKAKGTYDPNRLFGV---------TTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGR 206
                        ||...:|.|:         |.||..|.:..:|:.|.:.|...|..::|.| |.
Zfish   166 ------------TYVTWKLSGLPKHRVIGSGTNLDSARFRYLMAERLGIHPSSFNGWILGEH-GD 217

  Fly   207 TILPI----------LSQCDPPF-KGTDKER-EALIQRIQNAGTEVVNAKD------GLGSATLS 253
            :.:|:          |.:.:|.. |.||:|. :...:::.::..||:..|.      ||..|.|:
Zfish   218 SSVPVWSGANVAGVSLQKLNPDIGKDTDRENWKETHKKVVDSAYEVIRLKGYTNWAIGLSVADLT 282

  Fly   254 MAFA----ATQFVSSLIKGIKGSKDE------CIVECAYVESDV 287
            .:..    ....||:::||:.|..||      |::..|.|.|.|
Zfish   283 ESIMKNLNRVHPVSTMVKGMYGISDEVYLSLPCVLNSAGVGSVV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 79/304 (26%)
MDH_euk_gproteo 29..345 CDD:130833 79/304 (26%)
ldhbbXP_005170715.1 LDH_1 55..351 CDD:133429 71/292 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.