DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and MDH2

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_005909.2 Gene:MDH2 / 4191 HGNCID:6971 Length:338 Species:Homo sapiens


Alignment Length:307 Identity:158/307 - (51%)
Similarity:216/307 - (70%) Gaps:2/307 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPFEGKNGLKKAM 93
            ||||:|:.||||||||||||::|.:|.|:||||.:|.||..|||||.|:|:|..:.|...|...:
Human    26 KVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDCL 90

  Fly    94 DKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPINVIVPIVATIL 158
            ...|:||||||:||||||.|:||.:.||::...:..|.::.||.||:..|.||:|..:||.|.:.
Human    91 KGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAEVF 155

  Fly   159 KAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTILPILSQCDPPFKGTD 223
            |..|.|:||::|||||||:|||.||||::..:||.:||:||||||.|:||:|::|||.|......
Human   156 KKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQ 220

  Fly   224 KEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKGIKGSKDECIVECAYVESDVT 288
            .:..||..|||.||||||.||.|.||||||||:|..:||.||:..:.|.  |.:|||::|:|..|
Human   221 DQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGK--EGVVECSFVKSQET 283

  Fly   289 EAQFFATPLILGPQGVKENTGLPDLDDEERKALNGMLPILKESIAKG 335
            |..:|:|||:||.:|:::|.|:..:...|.|.::..:|.||.||.||
Human   284 ECTYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 158/307 (51%)
MDH_euk_gproteo 29..345 CDD:130833 158/307 (51%)
MDH2NP_005909.2 MDH_glyoxysomal_mitochondrial 26..334 CDD:133422 158/307 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56560
OrthoDB 1 1.010 - - D366623at33208
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.