DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and mdh1aa

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001303854.1 Gene:mdh1aa / 399662 ZFINID:ZDB-GENE-040204-1 Length:354 Species:Danio rerio


Alignment Length:329 Identity:69/329 - (20%)
Similarity:120/329 - (36%) Gaps:90/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSVGGIGQPLSL-LLKHNPQISTLSLYDIKNTTGVGVDLSH--INTRASVCPFEGKNGLKKAMDK 95
            |.|.|..||:.| ||...|.:..|.        ||.::|..  :.....|.|   .:.::.....
Zfish    27 GDVFGKDQPIILVLLDITPMLPVLD--------GVVMELQDCALPLLREVIP---TDKVEVGFKD 80

  Fly    96 ADIVVIPAGLPRKPGMKREDLVDVNASV------ACEVAFAASEVCPGAMLAFITNPINVIVPIV 154
            .|..::...:|||.||:|:||:..|.::      |.| .:|...|    .:..:.||.|....|.
Zfish    81 LDAAILVGSMPRKEGMERKDLLKANVAIFKTQGEALE-KYAKKTV----KVLVVGNPANTNCLIA 140

  Fly   155 ATILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKV-NIPVIGGHT-------------- 204
            :   |:..:........:|.||..||::.||..:.|....| |:.:.|.|:              
Zfish   141 S---KSAPSIPKENFSCLTRLDHNRARSQVAMRVGVPSDSVKNVTIWGNHSSTQYPDVHHAIVTR 202

  Fly   205 -GRTILPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKG 268
             |:.|....:..|..:...|     .|..:|..|..|:.|:      .||.|.:|.:.:...::.
Zfish   203 NGKEIAAFDAVNDESWLKGD-----FISTVQQRGAAVIKAR------KLSSAMSAAKAICDHMRD 256

  Fly   269 IKGSKDECIVECAYVESDVTEAQFFATP----LILGPQGVKENTGLPD---------LDDEERKA 320
            |                      :|.||    :.:|......:.|:||         :.::..|.
Zfish   257 I----------------------WFGTPDGEWVSMGIYSSGNSYGVPDDLMYSFPVKIKNKSWKV 299

  Fly   321 LNGM 324
            ::|:
Zfish   300 VDGL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 69/329 (21%)
MDH_euk_gproteo 29..345 CDD:130833 69/329 (21%)
mdh1aaNP_001303854.1 PRK05442 1..326 CDD:235468 69/329 (21%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 69/329 (21%)
PTS1 352..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.