DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and LDHB

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_006719137.1 Gene:LDHB / 3945 HGNCID:6541 Length:353 Species:Homo sapiens


Alignment Length:273 Identity:57/273 - (20%)
Similarity:107/273 - (39%) Gaps:59/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDI--KNTTGVGVDLSHINTRASVCPFEGKNGLKK 91
            |:.||| ||.:|...::.:........|:|.|:  ....|..:||.|           |...|:.
Human    23 KITVVG-VGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQH-----------GSLFLQT 75

  Fly    92 AMDKAD----------IVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNP 146
            ....||          |||:.||:.::.|..|.:||..|.:|...:.....:..|..::..::||
Human    76 PKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNP 140

  Fly   147 INVIVPIVATILKAKGTYDPNRLFGV---------TTLDVVRAQTFVADILNVDPQKVNIPVIGG 202
            ::::            ||...:|.|:         ..||..|.:..:|:.|.:.|...:..::|.
Human   141 VDIL------------TYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGE 193

  Fly   203 H--------TGRTILPILSQCDPPFKGTDKERE---ALIQRIQNAGTEVVNAKDGLGSATLSMAF 256
            |        :|..:..:..|...|..|||.:.|   .:.:.:..:..||:..|   |....::..
Human   194 HGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLK---GYTNWAIGL 255

  Fly   257 AATQFVSSLIKGI 269
            :....:.|::|.:
Human   256 SVADLIESMLKNL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 57/273 (21%)
MDH_euk_gproteo 29..345 CDD:130833 57/273 (21%)
LDHBXP_006719137.1 LDH_1 20..279 CDD:133429 57/273 (21%)
L-LDH-NAD 26..279 CDD:273796 56/270 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.