DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and LDHA

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001158886.1 Gene:LDHA / 3939 HGNCID:6535 Length:361 Species:Homo sapiens


Alignment Length:334 Identity:83/334 - (24%)
Similarity:143/334 - (42%) Gaps:58/334 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDI--KNTTGVGVDLSH----INTRASVCPFEGKN 87
            |:.||| ||.:|...::.:........|:|.|:  ....|..:||.|    :.|...|   .||:
Human    51 KITVVG-VGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIV---SGKD 111

  Fly    88 GLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPINVIVP 152
            ....|..|  :|:|.||..::.|..|.:||..|.::...:.....:..|...|..::||::::..
Human   112 YNVTANSK--LVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTY 174

  Fly   153 IVATILKAKGTYDPNRLFGV-TTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTILPILSQCD 216
            :.   .|..| :..||:.|. ..||..|.:..:.:.|.|.|...:..|:|.| |.:.:|:.|..:
Human   175 VA---WKISG-FPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEH-GDSSVPVWSGMN 234

  Fly   217 ---------PPFKGTDKERE---ALIQRIQNAGTEVVNAKD------GLGSATLSMA----FAAT 259
                     .|..||||::|   .:.:::..:..||:..|.      ||..|.|:.:    ....
Human   235 VAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRV 299

  Fly   260 QFVSSLIKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLPDLDDEE---RKAL 321
            ..||::|||:.|.||:.               |.:.|.|||..|:.:...:....:||   :|:.
Human   300 HPVSTMIKGLYGIKDDV---------------FLSVPCILGQNGISDLVKVTLTSEEEARLKKSA 349

  Fly   322 NGMLPILKE 330
            :.:..|.||
Human   350 DTLWGIQKE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 83/334 (25%)
MDH_euk_gproteo 29..345 CDD:130833 83/334 (25%)
LDHANP_001158886.1 LDH_1 48..358 CDD:133429 81/332 (24%)
L-LDH-NAD 54..353 CDD:273796 79/324 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.