DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and CG13334

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001246301.1 Gene:CG13334 / 36510 FlyBaseID:FBgn0033856 Length:361 Species:Drosophila melanogaster


Alignment Length:335 Identity:81/335 - (24%)
Similarity:129/335 - (38%) Gaps:80/335 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDI--KNTTGVGVDLSHIN---TRASVCPFEGKNG 88
            |::|||: |.:|..:|.:|........|.:.||  :......:|..|.:   :.|.|.|......
  Fly    50 KISVVGA-GQVGTAISAMLLLRNLTKNLVILDINYELAKAEALDFQHASAFLSDARVVPCGDSTN 113

  Fly    89 LKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAA----SEVCPGAMLAFITNPINV 149
            .|    .:|:|:|.|| .|..|..|..|..:..:|  |:...|    .|:.|.|....|:||.:|
  Fly   114 SK----DSDVVIITAG-ARPSGKDRSRLAAMQKTV--EILKKAVPKLVELSPNATFIIISNPADV 171

  Fly   150 IVPIVATILKAKGTYDPNRLFGVTT---LDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTILPI 211
            :...|..|.    ....:|.|  ||   ||.||.:..:|:.|.:.|.:|:..|||.| |.:.:|:
  Fly   172 MTYAVQRIT----NLPKHRCF--TTGCHLDTVRFRNLIANRLRLPPSQVHGYVIGEH-GASAVPV 229

  Fly   212 LSQ----------------CDPPFKGTDKEREALI-QRIQNAGTEVVNAKDGLGSATLSMAFAAT 259
            .|.                |     |.|.|..|.| :::...|..|...|   |....::|....
  Fly   230 WSSVSIAGIRLNDVVKNLAC-----GDDPENWAKINKQVTTGGLAVAKTK---GYTNWAIALTCA 286

  Fly   260 QFVSSL-------------IKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLP 311
            ..|.::             :||:.|.:|..::               :.|.::...|:.....||
  Fly   287 DIVQAMSGGKGKIACVGTDMKGLNGIQDNVVL---------------SLPCLVTAGGISHVFELP 336

  Fly   312 DLDDEERKAL 321
            ..|.|:.|.|
  Fly   337 LTDVEQSKLL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 81/335 (24%)
MDH_euk_gproteo 29..345 CDD:130833 81/335 (24%)
CG13334NP_001246301.1 LDH_1 46..358 CDD:133429 81/335 (24%)
L-LDH-NAD 53..354 CDD:273796 80/332 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.