DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and Mdh1b

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_038939577.1 Gene:Mdh1b / 316444 RGDID:1307874 Length:565 Species:Rattus norvegicus


Alignment Length:216 Identity:39/216 - (18%)
Similarity:75/216 - (34%) Gaps:68/216 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 IVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPVIGGH-TGRTILPILSQCD 216
            |:|..|..:|                :|:..:|..:...|.::...:|.|: ||...:.:     
  Rat   314 IIAVALGLEG----------------QAKAVLARKMKTIPSRIKDVIIWGNITGNNYVDL----- 357

  Fly   217 PPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKGIKG----SKDECI 277
                     |:|.:...::|    :....|...:.||:.|.........::.:|.    .|....
  Rat   358 ---------RKAKVYNYESA----IRGPPGYYHSVLSLIFDREWITKEFVRTLKDLSSTGKQFGG 409

  Fly   278 VECAYVESDVTEAQFFATP----LILG---------PQGVK-------EN------TGLPDLDDE 316
            :..|:..:...:..::.:|    :.||         |:|:.       ||      |.|.||...
  Rat   410 ILAAHSIATTLKYWYYGSPPGEIVSLGVMSEGQFGIPEGIVFSMPVKFENGTWVVLTDLEDLSLS 474

  Fly   317 ER--KALNGMLPILKESIAKG 335
            |:  ..|.|.| |.::.:|.|
  Rat   475 EKIINRLTGDL-IQEKLVASG 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 39/216 (18%)
MDH_euk_gproteo 29..345 CDD:130833 39/216 (18%)
Mdh1bXP_038939577.1 NADB_Rossmann 44..494 CDD:419666 38/214 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.