DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and Mdh1

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001303806.1 Gene:Mdh1 / 24551 RGDID:3072 Length:355 Species:Rattus norvegicus


Alignment Length:336 Identity:78/336 - (23%)
Similarity:128/336 - (38%) Gaps:67/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LKVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPFEG-KNGLKK 91
            ::|.|.|:.|              ||:...||.|.|.:..|.|...|.....:.|..| .:|:..
  Rat     5 IRVLVTGAAG--------------QIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLM 55

  Fly    92 --------------AMDK-------ADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVC 135
                          |.||       .|:.|:...:||:.||:|:||:..|..:......|..:..
  Rat    56 ELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYA 120

  Fly   136 PGAMLAFIT-NPINVIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPV 199
            ..::...:. ||.|.   ...|..|:..:........:|.||..||::.:|..|.|....|...:
  Rat   121 KKSVKVIVVGNPANT---NCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVI 182

  Fly   200 IGGHTGRTILPILSQCDPPFKGTDKE---REAL----------IQRIQNAGTEVVNAKDGLGSAT 251
            |.|:...|..|.::......:|  ||   .|||          |..:|..|..|:.|:      .
  Rat   183 IWGNHSSTQYPDVNHAKVKLQG--KEVGVYEALKDDSWLKGEFITTVQQRGAAVIKAR------K 239

  Fly   252 LSMAFAATQFVSSLIKGIKGSKDECIVECAYVESD-----VTEAQFFATPLILGPQGVKENTGLP 311
            ||.|.:|.:.:|..|:.|.....|.......|.||     |.:...::.|:::..:..|...|||
  Rat   240 LSSAMSAAKAISDHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLP 304

  Fly   312 DLDDEERKALN 322
             ::|..|:.::
  Rat   305 -INDFSREKMD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 78/336 (23%)
MDH_euk_gproteo 29..345 CDD:130833 78/335 (23%)
Mdh1NP_001303806.1 MalateDH-SF1 2..327 CDD:130820 78/336 (23%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 78/336 (23%)
PTS1 353..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.